DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and CG17568

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:586 Identity:137/586 - (23%)
Similarity:227/586 - (38%) Gaps:123/586 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFLCTQTVDDAAGNIEFASEEADSLG-----LRCIIEKHFWLQIP-DSKRAGYVCGPCW---EQL 58
            |.||.:  |||.||::....| :|.|     |...|.|:|.:|:. :.:.:..:|..|:   .:|
  Fly    11 CRLCAK--DDAHGNVKVQMNE-NSQGNWDNVLIMAIRKYFEVQMQLEDELSSVLCTECYTLISEL 72

  Fly    59 LLFHNFYLNVEQAHKALEQTVLKETSPPEVVASALEEHIVKSEHDDSVAAAVKRRRGRPRKVAQQ 123
            :.|......|:...:.|.:|   ||...:             |.|   .||::::.|    :...
  Fly    73 IDFAEHVTKVQDIFEVLRRT---ETDGDQ-------------EMD---VAALRQQFG----LCDD 114

  Fly   124 DAREELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDFLPDDCISKEGAEDPEVLEKKPPT- 187
            |....:|.:             |..::...:|.  |:..:.|.|..:::..:::.|:.::...| 
  Fly   115 DWTHIIKPI-------------PALEMESDNVY--QKPAELLKDFPLAETSSQEMEISKRTTTTH 164

  Fly   188 ---LKRKVSGRSRGRRRVQLAE---RPNTSCLPKIQKSQEFNDYIREHYKVQCHICNLPMEDFSE 246
               .|:.|......:..:.|..   ..|||.|       :..|.:.|          ||.|:.|:
  Fly   165 LIQTKKNVEMEIPKQEFIDLGPILLEKNTSQL-------DMEDVLDE----------LPQEELSQ 212

  Fly   247 -------MLAHVRREHKQRGYAMC-CNRKFLK-RGVLVDHLRRHQDPETFKCSICGRVMGHRRSL 302
                   ..|.:..:.|......| .:..||. .|.|:|.:.....|.|                
  Fly   213 PRLDSTTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNT---------------- 261

  Fly   303 ELHMRMHEIKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKV-------PCTHCEKTYPSQ 360
             |.....|...|||: .||:|.|.:.:...||:|......|.:.:|       .|..|.||..|.
  Fly   262 -LESTAEEKAKRGRM-DCEKCGKVYRNRASYEKHLERECRRIERRVKVDKTTTTCDICNKTLSSA 324

  Fly   361 YTMQQHVKLVHLNLYAKICDVCGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKYGLARH 425
            ..::.|.:.:|.|:...|||.|||.::...||..|...||  .....:|.:|.:....:..|..|
  Fly   325 TALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHT--ESRPFECTVCKAGFKNRARLKAH 387

  Fly   426 IKMMHTAENLQP-MQCEFCLKICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKRPNELKEHMTTH 489
            .::     :.:| ..|..|.|...:.:....| |..|...|..:|.:|...|||...||.|:.:|
  Fly   388 YQI-----HAEPSFVCNICGKKLQTRRTWNMH-KVVHTEERRLKCDVCGALFKRSKTLKTHLLSH 446

  Fly   490 TGEVLYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTI--IAVSVRK----TT 548
            ||...|.|.:|.::|..|||..:|:.|.|.:|.::....||.......|:  :.|..:|    ||
  Fly   447 TGLRPYVCNYCGKSFACNANCRSHKLKKHPQEVQQEDGARLPSRLNVPTLDELRVMTQKLPKGTT 511

  Fly   549 E 549
            |
  Fly   512 E 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 14/64 (22%)
C2H2 Zn finger 264..281 CDD:275368 5/17 (29%)
C2H2 Zn finger 289..309 CDD:275368 1/19 (5%)
C2H2 Zn finger 320..340 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..369 CDD:275368 6/18 (33%)
C2H2 Zn finger 440..461 CDD:275368 5/20 (25%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871 21/78 (27%)
COG5048 <313..471 CDD:227381 49/165 (30%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
C2H2 Zn finger 371..391 CDD:275368 4/24 (17%)
C2H2 Zn finger 398..418 CDD:275368 5/20 (25%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.