DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and kmg

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:561 Identity:102/561 - (18%)
Similarity:187/561 - (33%) Gaps:142/561 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QIPDSK-RAGYVCGPCWEQLLLFHNFYLNVEQAHKALEQTVLKETSPPEVVASALEEHIVKSEH- 102
            ::|..| |..|.|..|        .|:....::|    .:.|::.....:|.:..:..:..|.| 
  Fly   107 ELPQCKIRRNYSCNQC--------AFFTQNPRSH----LSHLRDVHGERIVINECKLCLYASRHF 159

  Fly   103 --------------DDSVA-----AAVKRRRGRPRKVAQQDAREELK-----------SVLEQIN 137
                          ||..|     |..:.:|...|:|.::...|.::           |||..|.
  Fly   160 QKLVRHMKMVHGCSDDGGAVQGSGAQPRGKRNLSREVRKRRLEESIEGQGATGQCLDLSVLRMIQ 224

  Fly   138 ----LNEIKIEFPEADL-TIADVLEDQEEQDFLP--------DDCISKEGAEDPEVL-EKKPPTL 188
                |.::|:|..:.:: .:|.|.....:|:.|.        |:..|.......::: .|:..:|
  Fly   225 NGPPLEQLKVELQQQEMQLLASVQAYNRQQEMLQLQQIVESHDNIFSMAYEFQTKLMPPKQAESL 289

  Fly   189 KRKVSGRSRGRRRVQLAERPNTSCLPKIQKSQEFNDYIREHYKVQCHICNLPMEDFSEMLAHVRR 253
            |.:....|........:..|:|..|  :...::|          ||..|:......:....||:.
  Fly   290 KLEQQNSSSDSEETAKSPSPDTREL--VSGKEQF----------QCQKCSYSTPIRARFKKHVKY 342

  Fly   254 EHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICGRVMGHRRSLELH-------MRMHEI 311
            ..........|:.....:..|..|.:.|.....||||.|......::||.:|       |.:|::
  Fly   343 HSMPLIKCSSCDFHTPYKWNLDRHTKNHGANGHFKCSCCDFSTDIKQSLTIHESNHHVPMPVHQM 407

  Fly   312 KSRGR-----LYRCEQCS-----KAFYS--AVVYERHKLTHIPREQWKVPCTHCEKTYPSQYTMQ 364
            .:|.|     |.. :|.|     :.|.:  |.|.....|  :||.. .:.|:||:|...:...:.
  Fly   408 GNRSRDEAEDLVD-QQSSGSRKPETFKNGGATVASTESL--LPRTS-GIVCSHCQKRVGNAMQLI 468

  Fly   365 QHVKLVHLNLYAKICDVCGKSIRGREALARHMEEHTGG-PQAAIKCHLCDSMLTTKYGLARHIKM 428
            .|:::..|.|:        .:.:.:.::...::.|... |.|......|.......||....: :
  Fly   469 NHLQVCTLALH--------NTTQLQASINAEVDLHDEDFPNAPTDLSYCGVETAPGYGEVTEV-L 524

  Fly   429 MHTAENLQPMQCEFCLKICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKRPNELKEHMTTHTGEV 493
            ....|:|.|::..|                         :||.|.......:....|:..|....
  Fly   525 PEEPEDLAPLKKVF-------------------------KCPHCSFWAATASRFHVHIVGHLNRK 564

  Fly   494 LYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSR 534
            .:.|..|  .:.||            ..|:..:|.||...|
  Fly   565 PFECSLC--AYRSN------------WRWDITKHIRLKALR 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 8/37 (22%)
C2H2 Zn finger 264..281 CDD:275368 3/16 (19%)
C2H2 Zn finger 289..309 CDD:275368 7/26 (27%)
C2H2 Zn finger 320..340 CDD:275368 6/26 (23%)
C2H2 Zn finger 350..369 CDD:275368 5/18 (28%)
C2H2 Zn finger 440..461 CDD:275368 1/20 (5%)
C2H2 Zn finger 469..489 CDD:275368 4/19 (21%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 4/19 (21%)
C2H2 Zn finger 568..586 CDD:275370 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.