DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and CG11696

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:654 Identity:179/654 - (27%)
Similarity:287/654 - (43%) Gaps:129/654 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPCFLCTQTVDDAAGNIEFASEEADSLG------LRCIIEKHFWLQIPDSKRAG-YVCGPCWEQL 58
            |.|.||   ::||...:....:| ..:|      |..:||:|..|.:.::.... .:|..||.||
  Fly     1 MICRLC---LEDAEHGVPIFGQE-PPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQL 61

  Fly    59 LLFHNFYLNVEQAHKALEQTVLKETSPPEV--------------VASALE-----------EHIV 98
            .....|...|.:..::|.:::..:|..||:              ..|.:|           :||:
  Fly    62 AEIEQFCSMVAEKQRSLHRSLQLKTELPELPELTEPEPALVVWNTESPIEPKLSYEGDDIKDHIL 126

  Fly    99 KSEHDDSVAAA-------------------------------VK-RRRGRPRKVAQQDA------ 125
            .....|:::|.                               || |.||||||.|.|..      
  Fly   127 CEPVIDALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKR 191

  Fly   126 -----REELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDFLPDDCISKEGAED------PE 179
                 :::.|:.:.:::|.|.:....|...:.|...:||:..:       .:|..||      |:
  Fly   192 KYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQDGDE-------DEEDEEDVGGELTPD 249

  Fly   180 VLEKKPPTLKRKVSGRSRGRRRVQLAERPNTSCLP-KIQKSQEFNDYIREHYKVQCHICNLPMED 243
            ..|:..|..||   ||.:.::.|...:..:||.:| |....:|.:|||..:.|:.|.||..|:||
  Fly   250 ADEQPKPRGKR---GRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAICAAPLED 311

  Fly   244 FSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICGRVMGHRRSLELHMRM 308
            |:::..|.|.||...||..|||.::.||.:.||||..|:||:.|.|..|.:...:|.|..:||..
  Fly   312 FNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLR 376

  Fly   309 HEIKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHCEKTYPSQYTMQQHVKLVHLN 373
            ...:.:..:::|..|...|....:...|...|...|:.:| |..|.||:.:::.:..|||.:|..
  Fly   377 FHSQQQELVHQCAICEARFAKKFLLTMHLKGHKGTERPEV-CDTCSKTFRTKFELSAHVKRMHAA 440

  Fly   374 LYAK-ICDVCGKSIRGREALARHMEE-HTGGPQAAIKCHLCDSMLTTKYGLARHIKMMHTAENLQ 436
            .:.. |||:||...|.:.....|.:. |..||.|.::|.||...|..:..|.:|:......:...
  Fly   441 DFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDGDT 505

  Fly   437 PMQCEFCLKICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKRPNELKEHMTTHTGEVLYTCPHCP 501
            ..:|..|.....|..|...|::| |::|:.|:|.:|:|.||.|..|.|||.||||..||.|..|.
  Fly   506 KYRCLLCNAEKSSRAALSSHMRY-HHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFCT 569

  Fly   502 QTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTIIAVSVRKTTETRQDGGLVPAEAIATTS 566
            :||.|:||||.|:||:|..:|                     |||.::        |:.:|.:|:
  Fly   570 RTFKSHANMHNHKKKMHPNDW---------------------VRKYSQ--------PSSSITSTA 605

  Fly   567 SPRA 570
            :|.|
  Fly   606 APLA 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 15/62 (24%)
C2H2 Zn finger 264..281 CDD:275368 8/16 (50%)
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 320..340 CDD:275368 4/19 (21%)
C2H2 Zn finger 350..369 CDD:275368 6/18 (33%)
C2H2 Zn finger 440..461 CDD:275368 6/20 (30%)
C2H2 Zn finger 469..489 CDD:275368 10/19 (53%)
C2H2 Zn finger 497..515 CDD:275368 10/17 (59%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 19/79 (24%)
C2H2 Zn finger 332..349 CDD:275368 8/16 (50%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 4/19 (21%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 447..465 CDD:275368 6/17 (35%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..529 CDD:275368 6/20 (30%)
C2H2 Zn finger 537..557 CDD:275368 10/19 (53%)
C2H2 Zn finger 565..583 CDD:275368 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10496
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.