DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and Traf6

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001101224.1 Gene:Traf6 / 311245 RGDID:1306853 Length:530 Species:Rattus norvegicus


Alignment Length:256 Identity:61/256 - (23%)
Similarity:98/256 - (38%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NTSCLPKIQ-KSQEFNDYIREHYKVQCHICNLPMEDFSEMLAHVRREHKQR--GYAMC------- 263
            ::|.:.:|| ...||:..:...|  :|.||.:.:           ||..|.  |:..|       
  Rat    46 SSSFMEEIQGYDVEFDPPLESKY--ECPICLMAL-----------REAVQTPCGHRFCKACITKS 97

  Fly   264 -------C---NRKFLKRGVLVDHLRRHQDPE-TFKCSICGRVMGHRRSLEL-HMRMHEIKSRGR 316
                   |   |...|:..:..|:..:.:... |.||...|.|    :.:|| |:..|::.....
  Rat    98 IRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCV----QKMELRHLEDHQVHCEFA 158

  Fly   317 LYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHC--EKTYPSQYTMQQHVKLVHLNLYAKIC 379
            |..|.||.: |:......:|.:...||.|  |.|.:|  ...|..:....|...|.::     ||
  Rat   159 LVICPQCQR-FFQKCQINKHIIEDCPRRQ--VSCVNCAVPMPYEEKEIHDQSCPLANI-----IC 215

  Fly   380 DVCGKSIRGREALARHMEEHTGGPQAAIKCHL----CDSMLTTKYGLARHIKMMHTAENLQ 436
            :.|| :|..||.:..|.:  ...|.|.:.|..    |...:...: ||||::     ||.|
  Rat   216 EYCG-TILIREQMPNHYD--LDCPTAPVPCTFSVFGCHEKMQRNH-LARHLQ-----ENTQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 4/19 (21%)
C2H2 Zn finger 289..309 CDD:275368 6/20 (30%)
C2H2 Zn finger 320..340 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..369 CDD:275368 4/20 (20%)
C2H2 Zn finger 440..461 CDD:275368
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
Traf6NP_001101224.1 Interaction with TAX1BP1. /evidence=ECO:0000250 1..362 61/256 (24%)
mRING-HC-C3HC3D_TRAF6 67..124 CDD:319557 13/69 (19%)
PLN03086 <132..219 CDD:178635 25/98 (26%)
TRAF6_Z2 157..183 CDD:407885 6/26 (23%)
zf-TRAF 204..261 CDD:280357 16/65 (25%)
DUF460 <273..>352 CDD:421465
MATH_TRAF6 359..508 CDD:239745
Interaction with TANK. /evidence=ECO:0000250|UniProtKB:Q9Y4K3 363..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.