DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and Zfp93

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001100016.1 Gene:Zfp93 / 296399 RGDID:1309760 Length:427 Species:Rattus norvegicus


Alignment Length:525 Identity:110/525 - (20%)
Similarity:176/525 - (33%) Gaps:171/525 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KRRRGRPRKVAQQDAREELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDF-LPDDCISKEG 174
            :|::.:|:.:..|:.:.|         .||.....|......|..||:..::.. ||        
  Rat     3 RRKQAKPQHLRSQEPQPE---------RNEPGGVAPRTAGEPASALENAAQKPAGLP-------- 50

  Fly   175 AEDPEVLEKKP-----PTLKRKVSGRSRGRRRVQLAERPNTSCLP-----KIQKSQEFNDYIREH 229
            |||.:.  ::|     ||.:.|       .|...|.||....|.|     .:...::.:.::|.|
  Rat    51 AEDSDA--QQPAAVALPTSEAK-------ERTATLGERTFNCCYPGCHFKTVHGMKDLDRHLRIH 106

  Fly   230 YKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICGR 294
            ...:.|.|..                        |::.|.::..|..|:|.|...:..||.:|..
  Rat   107 TGDKPHKCEF------------------------CDKCFSRKDNLTMHMRCHTSVKPHKCHLCDY 147

  Fly   295 VMGHRRSLELHMRMHEIKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHCEKTYPS 359
            ......||:.|:|:|   |..|.|:|:.|..|..::                            |
  Rat   148 AAVDSSSLKKHLRIH---SDERPYKCQMCPYASRNS----------------------------S 181

  Fly   360 QYTMQQHVKLVHLNLYAK----ICDVCGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKY 420
            |.|       |||..:..    .|.:|....:....|.|||..|:|  :...||..||...|.|.
  Rat   182 QLT-------VHLRSHTGDTPFQCWLCSAKFKISSDLKRHMIVHSG--EKPFKCEFCDVRCTMKA 237

  Fly   421 GLARHIKMMHTAENL----------------------QPMQCEFCLKICPSLQAHQHHIKYTHNT 463
            .|..||::.||.:.|                      .|.:|..|...|.|..|.:.|.: .|..
  Rat   238 NLKSHIRIKHTFKCLHCAFQGRDRADLLEHSRLHQADHPEKCPECSYSCSSPAALRVHSR-VHCK 301

  Fly   464 ARSHQCPMCEKAFKRPNELKE-----------------------------HMTTHTGEVLYTCPH 499
            .|..:|..|....|||:.|.:                             |:|....:..:.|..
  Rat   302 DRPFKCDFCSFDTKRPSSLAKHIDKVHRERAKTENRAPQGKDGPRESGPHHVTNIVTQKAFRCDK 366

  Fly   500 CPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTIIAVSV-RKTTETRQDGGLVPAEAIA 563
            |..:|..:.::..|:|:  ..:|.||::..|           ||. .:...:.|.|.||..|.:.
  Rat   367 CGASFARDDSLRCHQKQ--HSDWGENKNSNL-----------VSFPLEGIASGQLGPLVSVEQLE 418

  Fly   564 TTSSP 568
            :|..|
  Rat   419 STLEP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 5/16 (31%)
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
C2H2 Zn finger 320..340 CDD:275368 3/19 (16%)
C2H2 Zn finger 350..369 CDD:275368 3/18 (17%)
C2H2 Zn finger 440..461 CDD:275368 6/20 (30%)
C2H2 Zn finger 469..489 CDD:275368 8/48 (17%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
Zfp93NP_001100016.1 COG5048 <96..227 CDD:227381 39/194 (20%)
zf-H2C2_2 98..123 CDD:290200 6/48 (13%)
C2H2 Zn finger 114..134 CDD:275368 6/43 (14%)
C2H2 Zn finger 142..162 CDD:275368 6/19 (32%)
C2H2 Zn finger 170..190 CDD:275368 9/54 (17%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
zf-H2C2_2 210..234 CDD:290200 10/25 (40%)
C2H2 Zn finger 226..245 CDD:275368 8/18 (44%)
C2H2 Zn finger 279..299 CDD:275368 6/20 (30%)
C2H2 Zn finger 307..328 CDD:275368 6/20 (30%)
C2H2 Zn finger 364..384 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.