DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and Zfp91

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001162591.1 Gene:Zfp91 / 246282 RGDID:628736 Length:568 Species:Rattus norvegicus


Alignment Length:505 Identity:106/505 - (20%)
Similarity:173/505 - (34%) Gaps:153/505 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EQAHKALEQTVLKETSPPEVVASALEEHIVKSEHD------DSVAAAVKRRR------------- 114
            :.|...|...|.....|.|..:|    .:::...|      .:.||||.|||             
  Rat    25 DAASDELRSGVAAAAKPAETASS----RVLRGGRDRGRTAAAAAAAAVSRRRKAEYPRRRRSSPS 85

  Fly   115 -------------GRPRKVAQQDAREELKSVLEQINLNEIKIEFPEADLTIADVLEDQEEQDFLP 166
                         .:|...||......|:.: |:|.             |..|..|::|:...||
  Rat    86 NRPPDGHGHQPAAAKPPSPAQGKKSPRLQCI-EKIT-------------TDKDPKEEKEDDSVLP 136

  Fly   167 DDCISKEGAEDPEVLEKKPPTLKRKVSGRSRGRRRVQ---LAERPNTSCLPKIQKSQEFNDY--- 225
                     ::..:...:|....|..|..|..|.|..   .:.|..|..|..:.|::...|.   
  Rat   137 ---------QEVSITATRPSRSWRSSSRTSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDY 192

  Fly   226 -IREHYKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRGVLVDHLRRHQDP--ETF 287
             :.|.::....|.:...|:..|||                        :..:.:....||  ||:
  Rat   193 DVPEEHQSPSGISSDEEEEEEEML------------------------ISEEEIPFKDDPRDETY 233

  Fly   288 KCSI----------CGRVMGHRRSLELHMRMH-EIK--------------SRGRLYRCEQCSKAF 327
            |..:          .|:|...:...|:.:.:. |:|              .|||..:.:      
  Rat   234 KPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEPPRKRGRRRKDD------ 292

  Fly   328 YSAVVYERHKLTHIPREQWKVPCTH--CEK-------TYPSQYTMQQHVKLVHLNLYAKIC--DV 381
                     |...:|:.:.|.|..:  ||.       .:| :| :|.|:|..||.....:|  ..
  Rat   293 ---------KSPRLPKRRKKPPIQYVRCEMEGCGTVLAHP-RY-LQHHIKYQHLLKKKYVCPHPS 346

  Fly   382 CGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKYGLARHIKMMHTAENLQPMQCEFCLKI 446
            ||:..|.::.|.||.:.||  .|....|..|.....:.:.||.| :|:||.|  :|:|||.|...
  Rat   347 CGRLFRLQKQLLRHAKHHT--DQRDYICEYCARAFKSSHNLAVH-RMIHTGE--KPLQCEICGFT 406

  Fly   447 CPSLQAHQHHIKYTHNTARSHQ--CPMCEKAFKRPNELKEHMTTHTGEVL 494
            |....:...|:| .|:....:|  |.:|.|.|::.:.:..|......|||
  Rat   407 CRQKASLNWHMK-KHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071 2/7 (29%)
C2H2 Zn finger 264..281 CDD:275368 0/16 (0%)
C2H2 Zn finger 289..309 CDD:275368 3/29 (10%)
C2H2 Zn finger 320..340 CDD:275368 1/19 (5%)
C2H2 Zn finger 350..369 CDD:275368 6/27 (22%)
C2H2 Zn finger 440..461 CDD:275368 6/20 (30%)
C2H2 Zn finger 469..489 CDD:275368 5/19 (26%)
C2H2 Zn finger 497..515 CDD:275368
Zfp91NP_001162591.1 zf-C2H2_8 311..388 CDD:292531 23/80 (29%)
C2H2 Zn finger 345..364 CDD:275368 6/18 (33%)
C2H2 Zn finger 372..392 CDD:275368 6/20 (30%)
zf-H2C2_2 384..409 CDD:290200 13/27 (48%)
C2H2 Zn finger 400..420 CDD:275368 6/20 (30%)
C2H2 Zn finger 430..446 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.