DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and Traf6

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001290202.1 Gene:Traf6 / 22034 MGIID:108072 Length:530 Species:Mus musculus


Alignment Length:260 Identity:63/260 - (24%)
Similarity:97/260 - (37%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NTSCLPKIQ-KSQEFNDYIREHYKVQCHICNLPMEDFSEMLAHVRREHKQRGYAMCCNRKFLKRG 272
            ::|.:.:|| ...||:..:...|  :|.||.:.:           ||..|..    |..:|.|..
Mouse    46 SSSFMEEIQGYDVEFDPPLESKY--ECPICLMAL-----------REAVQTP----CGHRFCKAC 93

  Fly   273 VL-----------VDH---LRRHQDPETF----------KCSICGRVMGHRRSLEL-HMRMHEIK 312
            ::           ||:   |.....|:.|          ||...|.:    :.:|| |:..|::.
Mouse    94 IIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCL----QKMELRHLEDHQVH 154

  Fly   313 SRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHC--EKTYPSQYTMQQHVKLVHLNLY 375
            ....|..|.||.:.|....| ..|.:...||.|  |.|.:|  ...|..:....|...|.::   
Mouse   155 CEFALVNCPQCQRPFQKCQV-NTHIIEDCPRRQ--VSCVNCAVSMAYEEKEIHDQSCPLANI--- 213

  Fly   376 AKICDVCGKSIRGREALARHMEEHTGGPQAAIKCHL----CDSMLTTKYGLARHIKMMHTAENLQ 436
              ||:.|| :|..||.:..|.:  ...|.|.|.|..    |...:...: ||||::     ||.|
Mouse   214 --ICEYCG-TILIREQMPNHYD--LDCPTAPIPCTFSVFGCHEKMQRNH-LARHLQ-----ENTQ 267

  Fly   437  436
            Mouse   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 6/30 (20%)
C2H2 Zn finger 289..309 CDD:275368 5/20 (25%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..369 CDD:275368 4/20 (20%)
C2H2 Zn finger 440..461 CDD:275368
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
Traf6NP_001290202.1 Interaction with TAX1BP1. /evidence=ECO:0000250 1..362 63/260 (24%)
RING 69..107 CDD:238093 9/52 (17%)
zf-TRAF 204..261 CDD:280357 17/65 (26%)
SlyX 304..>356 CDD:294687
MATH_TRAF6 359..508 CDD:239745
Interaction with TANK. /evidence=ECO:0000250|UniProtKB:Q9Y4K3 363..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.