DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and PEX11G

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_542393.1 Gene:PEX11G / 92960 HGNCID:20208 Length:241 Species:Homo sapiens


Alignment Length:230 Identity:53/230 - (23%)
Similarity:93/230 - (40%) Gaps:31/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRDKIARLIQYASRAMWDSL-ESANSNPALVDNFKTVEYILSTFRKLLRFGKCVDVF-----YGA 71
            |||::.|::.|..:.:...| |...:...:......|...||..|.:||....:.:|     ||.
Human    16 GRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGL 80

  Fly    72 LKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTAVNAKRWSNIANKYWLFSIIMNLCR 136
              .....|..:|....|..|:..|:...:|..|.|...:..|::.||..::...|..|:::.:.|
Human    81 --GAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVAR 143

  Fly   137 DFYEILRVLDLHRSGSKSGISRCRIP-ASINSP-EDFKRLALQSYVLMQGHKDIVVDTVKNACDF 199
            ..:.:|::.           .|.|.| |...|| ...||.|:::.  ||..   .:..:.|..|.
Human   144 SLWMLLKLR-----------QRLRSPTAPFTSPLPRGKRRAMEAQ--MQSE---ALSLLSNLADL 192

  Fly   200 -----FIPLTALGYTSLTPRTIGLLGAISSLAGLW 229
                 ::|...|......|..:||:|.|||:..::
Human   193 ANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 53/230 (23%)
PEX11GNP_542393.1 PEX11 4..229 CDD:310329 53/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.