DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and PEX11B

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_003837.1 Gene:PEX11B / 8799 HGNCID:8853 Length:259 Species:Homo sapiens


Alignment Length:264 Identity:84/264 - (31%)
Similarity:138/264 - (52%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            ||..|:.:.|:..|:::.|..|||...:..:|:...::|.|....:.:|..||..|||||.|...
Human     1 MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSA 65

  Fly    66 DVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLT-AVNAKRWSNIANKYWLFS 129
            |....|.:.:|..|:.:|..:|:|.|:::|:...|:.||..::||. .|:.::|:..:.:|:|||
Human    66 DALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFS 130

  Fly   130 IIMNLCRDFYEILRVLDLHRS-------GSKSGISRCRIPASINS-------------PEDFKRL 174
            :||||.||.|||..:::...|       ||..|     :|....:             |:...:|
Human   131 LIMNLSRDAYEIRLLMEQESSACSRRLKGSGGG-----VPGGSETGGLGGPGTPGGGLPQLALKL 190

  Fly   175 ALQSYVL---MQGHKDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRA 236
            .||..:|   ::||..:::|.|:||||.||||..||.....|..:||.|.:||:..:..|:.|..
Human   191 RLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLVSSILSILTLIYPWL 255

  Fly   237 KLTP 240
            :|.|
Human   256 RLKP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 80/254 (31%)
PEX11BNP_003837.1 PEX11 1..250 CDD:310329 80/253 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..176 4/23 (17%)
Interaction with PEX19, PEX11G and FIS1 and peroxisome targeting. /evidence=ECO:0000269|PubMed:10704444, ECO:0000269|PubMed:20826455 211..259 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145164
Domainoid 1 1.000 132 1.000 Domainoid score I5115
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2852
Inparanoid 1 1.050 138 1.000 Inparanoid score I4532
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49577
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 1 1.000 - - otm41088
orthoMCL 1 0.900 - - OOG6_103414
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1731
SonicParanoid 1 1.000 - - X2920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.