DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and Pex11a

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_445939.1 Gene:Pex11a / 85249 RGDID:619842 Length:246 Species:Rattus norvegicus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:128/250 - (51%) Gaps:19/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            ||..:::.||:.|||::.|..|:|...:...|||.....|:|...|.:|..:||.||..|.|..:
  Rat     1 MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFRLGNVL 65

  Fly    66 DVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTA-VNAKRWSNIANKYWLFS 129
            .......::|...||..|:.|||:.|::.::...|..||....|||: :|.::|...|.:::.:.
  Rat    66 HAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQMRAARHYYYF 130

  Fly   130 IIMNLCRDFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLA------LQSYVL-----MQ 183
            ::::|.||.||:|    ||.  .:....|.:...|...|..:. :|      |||::|     ::
  Rat   131 LLLSLVRDLYEVL----LHM--GQVARDRAKREKSSGDPPKYS-VANEESEWLQSFLLLLFQSLK 188

  Fly   184 GHKDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKL 238
            .:..:.:|||||.||..|||..||........:|..|.:||:|||..::.|:.||
  Rat   189 RNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQLKL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 75/242 (31%)
Pex11aNP_445939.1 PEX11 1..237 CDD:283335 75/242 (31%)
Required for homodimerization, interaction with PEX11G, and peroxisomal localization. /evidence=ECO:0000250|UniProtKB:O75192 218..238 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338866
Domainoid 1 1.000 126 1.000 Domainoid score I5305
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4537
OMA 1 1.010 - - QHG49577
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 1 1.000 - - otm45229
orthoMCL 1 0.900 - - OOG6_103414
Panther 1 1.100 - - LDO PTHR12652
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.