DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and PEX11A

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_564514.1 Gene:PEX11A / 841186 AraportID:AT1G47750 Length:248 Species:Arabidopsis thaliana


Alignment Length:239 Identity:50/239 - (20%)
Similarity:95/239 - (39%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV-DVFYGALKTIH 76
            |.||:.::.:||::.:..| .......:::...|:.|..:...||..|.||.| |:  .||::..
plant    30 GVDKLLKISRYATKIILAS-SLIPETRSIIPRLKSFESSVGVSRKAFRLGKFVQDI--NALRSSR 91

  Fly    77 HPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTAVNAKR---------WSNIANKYWLFSIIM 132
            ....:..|.|.::...:.|:.|.:.|:||.::||  ::||.         |:.:.......||  
plant    92 WDSNHELVLLIIAYGGEGLYYFVEQFIWLTKSGL--IDAKHSKWLQKISAWAELVGYVGSVSI-- 152

  Fly   133 NLCRDFYEILRVLDLHRSGSKSGISRCRIPASIN-----SPEDFKRLALQSYVLMQGHKDIVVDT 192
                      ::.||.:...:.......|..|::     ..||.|...::....::     |:..
plant   153 ----------KIRDLRKLNDEESCVASTIEISVSRGLACDGEDEKMKMIKEKKTLK-----VLSI 202

  Fly   193 VKNACDFFIPLTAL----GYTSLTPRTI---GLLGAISSLAGLW 229
            :::..|..:.:..:    |..| .|..|   ||..||.|....|
plant   203 LQDLADGLMTIADIRDGKGVLS-APNVISSAGLFSAIVSTHKNW 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 50/239 (21%)
PEX11ANP_564514.1 PEX11 18..245 CDD:283335 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.