DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and PEX11E

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001078322.1 Gene:PEX11E / 825279 AraportID:AT3G61070 Length:231 Species:Arabidopsis thaliana


Alignment Length:244 Identity:70/244 - (28%)
Similarity:106/244 - (43%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCVDVFYGALK 73
            |:|..||||.|.|||.|:.:      :...|...   :||:...|..||:.|..|.|:.|:|.:.
plant    19 NKAEARDKICRAIQYGSKFL------SGGQPGTA---QTVDKNTSLARKVFRLFKFVNDFHGLIS 74

  Fly    74 TIHHPDLNIRVTLTLSKLSQSL---FLFADHFLWLARTGLTAVNAKR---WSNIANKYWLFSIIM 132
            .:  |.......:.|.|...:|   |||.|..:||.|:|:.. |.:|   ...|:...||.|   
plant    75 PV--PKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYK-NKERTELLGRISLFCWLGS--- 133

  Fly   133 NLCRDFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDIVVDTVKNAC 197
            ::|....||   .:|.|..|    |..::...:.:.::..|..||.      ..|..:..:|::.
plant   134 SVCTSAVEI---GELGRLSS----SMKKMEKELKADDELYRAKLQK------SNDRTLALIKSSM 185

  Fly   198 DFFIPLTALGYTSLTPRTI-----GLLGAISSLAGLWALLEPRAKL-TP 240
            |..:   |:|...|.|:||     |..|..:||...:.||..|.|| ||
plant   186 DIIV---AIGLLQLAPKTISPRVTGAFGFTTSLISCYQLLPSRPKLKTP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 63/233 (27%)
PEX11ENP_001078322.1 PEX11 11..222 CDD:398979 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3243
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.