DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and PEX11D

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001031544.1 Gene:PEX11D / 819182 AraportID:AT2G45740 Length:236 Species:Arabidopsis thaliana


Alignment Length:255 Identity:69/255 - (27%)
Similarity:104/255 - (40%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCVDVF 68
            :|...|:|..|||:.|.|||.|:.:      :...|....|   |:...|..||:.|..|.|:..
plant    15 VVMYLNKAEARDKLCRAIQYGSKFL------SGGQPGTAQN---VDKSTSLARKVFRLFKFVNDL 70

  Fly    69 YGALKTIHHPDLNIRVTLTLSKLSQSL---FLFADHFLWLARTGL--TAVNAKRWSNIANKYWLF 128
            :|.:..:  |.......:.|.|...:|   |||.|..:||.|:|:  ....|:....|:...|:.
plant    71 HGLISPV--PKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRISLFCWMG 133

  Fly   129 SIIMNLCRDFYEILRVLDLHRS------GSKSGISRCRIPASINSPED------FKRLALQSYVL 181
            |   ::|....|:..:..|..|      |.|:|          |..:|      .|:...:|..|
plant   134 S---SVCTTLVEVGEMGRLSSSMKKIEKGLKNG----------NKYQDEDYRAKLKKSNERSLAL 185

  Fly   182 MQGHKDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKL-TP 240
            ::...||||..         .|..|..|.:|||..|..|.|:|:...:.||..|.|: ||
plant   186 IKSAMDIVVAA---------GLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKTP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 63/244 (26%)
PEX11DNP_001031544.1 PEX11 12..227 CDD:398979 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3243
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.