DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and pex11a

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001025701.1 Gene:pex11a / 595093 XenbaseID:XB-GENE-970930 Length:247 Species:Xenopus tropicalis


Alignment Length:248 Identity:74/248 - (29%)
Similarity:121/248 - (48%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            ||..||:.||:.|||::.|..|||...:...:|:......|....|.||..:|:.|||.|.|..|
 Frog     1 MDLFVQITNQSQGRDRLFRATQYACMLLRYLVENKPGTQKLATKLKRVESNMSSGRKLFRLGNFV 65

  Fly    66 DVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGL-TAVNAKRWSNIANKYWLFS 129
            .....:..:|...|...|..||.:.|::.|:...|..||....|: :.::.:||.:.|.|.:.:|
 Frog    66 HALKASKASIQISDPIPRCCLTAANLNRVLYFVCDTVLWARSVGIVSGISKERWLSRATKCYYYS 130

  Fly   130 IIMNLCRDFYEILRVLDLHRSGSKSGISRCRIPASINS---------PEDFKRLALQSYVLMQGH 185
            :::|:..|.|||...::   ..:|....:.|..|:.:.         |:.|:...|..|:..:.|
 Frog   131 LLLNILMDIYEISWRME---KEAKERKQKARDTAAESDQDLKFLSVLPKGFENFLLLLYLSFRNH 192

  Fly   186 KDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKL 238
            ..:::||:||.||.|.||..|...|.:...||:.|.:|||.|:..:..|..|:
 Frog   193 PPLLLDTIKNVCDLFSPLDRLEIYSTSQGIIGICGLVSSLVGILTVANPSLKI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 72/240 (30%)
pex11aNP_001025701.1 PEX11 1..238 CDD:398979 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6004
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4630
OMA 1 1.010 - - QHG49577
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 1 1.000 - - otm48293
Panther 1 1.100 - - LDO PTHR12652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1731
SonicParanoid 1 1.000 - - X2920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.