DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and pex11g

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001025343.1 Gene:pex11g / 563203 ZFINID:ZDB-GENE-050913-79 Length:240 Species:Danio rerio


Alignment Length:238 Identity:53/238 - (22%)
Similarity:90/238 - (37%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCVDVF-----YGAL 72
            ||||:.|.:.|.|:.:...|...:...:|..:.......||..|..||....:.:.     ||..
Zfish    17 GRDKVIRTLCYGSQLVGGVLSGKSPQSSLGKSLLLFSAQLSHCRTTLRLFDDLSMLAYSSGYGLG 81

  Fly    73 KTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTAVNAKRWSNIANKYWLFSIIMNLCRD 137
            .:  ..|..:|....||.::..|:...:|..|.|...|....:.||..::...|..|:::::.|.
Zfish    82 GS--EEDALVRWMSVLSNVADQLYYPCEHIAWAADAELIKTKSDRWWVLSTGLWGASLVLSILRS 144

  Fly   138 FYEIL----RVLDLHRSGS----------KSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDI 188
            ...||    :....|||||          |:.:.|              ::..:.:.::....|:
Zfish   145 IRSILILKRKAQKCHRSGSAESREEVFSQKAALKR--------------QIRAELFSILSSSADL 195

  Fly   189 VVDTVKNACDFFIPLTALGYT---SLTPRTIGLLGAISSLAGL 228
            .     ||..:..|    |:.   ...|..:||:|..|||.||
Zfish   196 C-----NAVHWMPP----GFLWAGRFPPWLVGLMGTTSSLIGL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 53/238 (22%)
pex11gNP_001025343.1 PEX11 5..231 CDD:283335 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.