DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and prx-11

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_493273.1 Gene:prx-11 / 353387 WormBaseID:WBGene00004196 Length:214 Species:Caenorhabditis elegans


Alignment Length:237 Identity:48/237 - (20%)
Similarity:78/237 - (32%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            :|.|..:.:...||||..|     |.|.:..|:|..|    .||.|          ::|...|.:
 Worm    14 IDHLTTVLSSYAGRDKAIR-----SLAFYLQLKSTTS----PDNAK----------EILGLAKQL 59

  Fly    66 DVFYGALKTIHHPDL-----NIRVTLTLSKLSQSL-FL-------------FADHFLWLARTGLT 111
            .......:..:||.:     .|.......::...| ||             |.:...||:...:.
 Worm    60 SAARLVSRQFNHPGMLKSCRQIMQAFQTGRIGDPLEFLTGAAVTGIYTVYGFVELLAWLSDAKIL 124

  Fly   112 AVNAKRWSNIANKYWLFSIIMNLCRDFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLAL 176
            |.|:.|........||..:|..:.|....|.|          .||.:        |.||...|..
 Worm   125 AFNSARLYKWCLYLWLSELINGIVRQMRVIYR----------KGIEK--------SQEDILTLVG 171

  Fly   177 QSYVLMQG-----HKDIVVD--TVKNACDFFIPLTALGYTSL 211
            .|...:.|     ||.:...  :::.:..|.:..:.:|:..|
 Worm   172 LSSDFISGVNSLPHKILWAGKLSMRQSASFSLLASIIGFYKL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 48/237 (20%)
prx-11NP_493273.1 PEX11 14..214 CDD:283335 48/237 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.