DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and Pex11b

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001020855.1 Gene:Pex11b / 310682 RGDID:1310353 Length:258 Species:Rattus norvegicus


Alignment Length:258 Identity:82/258 - (31%)
Similarity:137/258 - (53%) Gaps:18/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            ||..|:.:.|:..|:::.|..|||...:..:|:...::|.|....:.:|..||..|||||.|...
  Rat     1 MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLEGHLSLGRKLLRLGNSA 65

  Fly    66 DVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLT-AVNAKRWSNIANKYWLFS 129
            |....|.:.:|..|:.:|..:|:|.|:::|:...|:.||..::||. .|:.::|:..:.:|:|||
  Rat    66 DALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFS 130

  Fly   130 IIMNLCRDFYEILRVLDLHRSG-------SKSGISRCRI--PASINSPED-FKRLALQSYV---- 180
            :||||.||.|||..:::...|.       |..|:|....  |....:|.. ..:|||:..:    
  Rat   131 LIMNLSRDAYEIRLLMEQETSAHSRRMKISGVGVSGLETGGPGGPGTPGGCLPQLALKFRLRILL 195

  Fly   181 ---LMQGHKDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKLTP 240
               :::.|..:::|.::||||.||||..||.....|..:||.|.|||:..:..|:.|..:|.|
  Rat   196 LARVLRDHPPLLLDVLRNACDLFIPLDKLGLWRCGPGIVGLCGLISSVLSILTLICPWLRLKP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 78/248 (31%)
Pex11bNP_001020855.1 PEX11 1..249 CDD:283335 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338865
Domainoid 1 1.000 126 1.000 Domainoid score I5305
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2852
Inparanoid 1 1.050 131 1.000 Inparanoid score I4537
OMA 1 1.010 - - QHG49577
OrthoDB 1 1.010 - - D1394894at2759
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 1 1.000 - - otm45229
orthoMCL 1 0.900 - - OOG6_103414
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.