DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and Pex11g

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001099372.1 Gene:Pex11g / 288369 RGDID:1307070 Length:241 Species:Rattus norvegicus


Alignment Length:228 Identity:50/228 - (21%)
Similarity:95/228 - (41%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRDKIARLIQYASRAMWDSL-ESANSNPALVDNFKTVEYILSTFRKLLRFGKCVDVF-----YGA 71
            |||::.|.:.|..:.:...| |...|...:......|...||..|.:||....:.:|     ||.
  Rat    16 GRDRLIRTLGYGCQLIGGVLVEQCPSRSEVGRRLLVVSAQLSHCRTVLRLFDDLAMFVYTKQYGL 80

  Fly    72 LKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLTAVNAKRWSNIANKYWLFSIIMNLCR 136
              .....|:.||....||.::..|:...:|..|.|...:..|::.||..::..:|..|:::...:
  Rat    81 --GAEEEDVFIRWLSVLSNMADQLYYPCEHVAWAADAKVLQVDSARWWTLSTAFWSLSLLLGAVK 143

  Fly   137 DFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDIVVDTVKNACDF-- 199
            ..:.:|::....|  |.:|....::|.|       |..|:::.:..:     .:..:.|..|.  
  Rat   144 SLWTMLKLRQKLR--SPTGHFASQLPRS-------KWRAVEARIWSE-----ALTLLSNLADLAN 194

  Fly   200 ---FIPLTALGYTSLTPRTIGLLGAISSLAGLW 229
               ::|...|......|..:||:|.|||:..::
  Rat   195 AVHWLPPGVLWAGCFPPWLVGLMGTISSILSVY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 50/228 (22%)
Pex11gNP_001099372.1 PEX11 4..229 CDD:283335 50/228 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.