DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and pex11

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_595177.1 Gene:pex11 / 2541114 PomBaseID:SPBC582.09 Length:238 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:51/235 - (21%)
Similarity:109/235 - (46%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCVD-- 66
            ::::.|....|||..|.:|:.::.:...|....|:.:.|:.:|.:|..:|..|||...||.:|  
pombe    13 VLRMLNSMPARDKTFRALQFVAKLLSWHLFYGGSSLSTVNKWKKLESNISFSRKLFSIGKVLDYI 77

  Fly    67 --VFYGALKTIHHP---DLNIRVTLTLSK-LSQSLFLFADHFLWLARTGL-TAVNAKRWSNIANK 124
              |::.:|| :.:|   :.:...|::.:| ::.:.:..|:...|..:|.| ...::|:.|.|..:
pombe    78 CKVYFDSLK-LQNPLSGNKSALPTISFTKDVAFAGYATAELIGWFNKTELMPCSHSKQISTIGKQ 141

  Fly   125 YWLFSIIMNLCRDFYEILRVLDLHRSGSKSGISRCRIPASINSPEDFKRLALQSYVLMQGHKDIV 189
            ....:::.:.....||:       :..||      :|.::.....:....:||:  |.:..|:|:
pombe   142 CLAVALLSSCLAGCYEL-------QQNSK------KIKSATQEASEKDSTSLQT--LQKERKEIL 191

  Fly   190 VDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLW 229
            ...::||.|..|||..|....:....:...|..:||..::
pombe   192 FFALQNALDATIPLAELDILKVNDGFVAAAGITTSLMSVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 51/235 (22%)
pex11NP_595177.1 PEX11 12..234 CDD:283335 51/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103414
Panther 1 1.100 - - LDO PTHR12652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1731
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.