DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex11 and Pex11b

DIOPT Version :9

Sequence 1:NP_611071.1 Gene:Pex11 / 36758 FlyBaseID:FBgn0034058 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001155859.1 Gene:Pex11b / 18632 MGIID:1338882 Length:259 Species:Mus musculus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:137/260 - (52%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDQLVQLNNQAGGRDKIARLIQYASRAMWDSLESANSNPALVDNFKTVEYILSTFRKLLRFGKCV 65
            ||..|:.:.|:..|:::.|..|||...:..:|:...::|.|....:.:|..||..|||||.|...
Mouse     1 MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLEGHLSLGRKLLRLGNST 65

  Fly    66 DVFYGALKTIHHPDLNIRVTLTLSKLSQSLFLFADHFLWLARTGLT-AVNAKRWSNIANKYWLFS 129
            |....|.:.:|..|:.:|..:|:|.|:::|:...|:.||..::||. .|:.::|:..:.:|:|||
Mouse    66 DALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFS 130

  Fly   130 IIMNLCRDFYEILRVLDLHRS-----------GSKSGISRCRIPASINSP-EDFKRLALQSYV-- 180
            :||||.||.|||..:::...|           |...|:.... |....:| ....:|||:..:  
Mouse   131 LIMNLSRDAYEIRLLMEQETSAYSRRMKVSGVGVSGGVETVG-PGGPGTPGGSLPQLALKFRLRI 194

  Fly   181 -----LMQGHKDIVVDTVKNACDFFIPLTALGYTSLTPRTIGLLGAISSLAGLWALLEPRAKLTP 240
                 :::||..:::|.::||||.||||..||.....|..:||.|.|||:..:..|:.|..:|.|
Mouse   195 LLLARVLRGHPPLLLDVLRNACDLFIPLDKLGLWRCGPGIVGLCGLISSILSILTLICPWLRLKP 259

  Fly   241  240
            Mouse   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex11NP_611071.1 PEX11 1..232 CDD:283335 78/250 (31%)
Pex11bNP_001155859.1 PEX11 1..250 CDD:283335 78/249 (31%)
Interaction with PEX19, PEX11G and FIS1 and peroxisome targeting. /evidence=ECO:0000250|UniProtKB:O96011 211..259 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835265
Domainoid 1 1.000 128 1.000 Domainoid score I5303
eggNOG 1 0.900 - - E1_KOG4186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2852
Inparanoid 1 1.050 133 1.000 Inparanoid score I4585
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49577
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003074
OrthoInspector 1 1.000 - - otm43159
orthoMCL 1 0.900 - - OOG6_103414
Panther 1 1.100 - - O PTHR12652
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1731
SonicParanoid 1 1.000 - - X2920
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.