DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and PFA4

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:67/242 - (27%)
Similarity:98/242 - (40%) Gaps:64/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLLILFAEFVVMRLILLPSNYTVFSTI----NMIIFQALAFLAFASHIRTMLSDPGAVPRGNATK 106
            ||.|....|:: ..|...::|.:.|..    ..|.|:....:.:.|:...:.::||. |..|   
Yeast     9 WLGIAIPTFLI-SFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICTNPGR-PLPN--- 68

  Fly   107 EMIEQMGYREGQMFYK--CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLF 169
                   |:.....::  |.||.|.||||:|||..|.:|:..|||||||..||||..|..:|:.|
Yeast    69 -------YKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRF 126

  Fly   170 TFYIASISVHTLFLVLTQFAECVKND-----W--RTCSPY------------SPPATIFLLLFLT 215
            .|:|         :|.|....|::..     |  |....|            |.|...|:||.: 
Yeast   127 LFWI---------IVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLTI- 181

  Fly   216 FEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSI 262
                     ||:.|......|||.::.||.       | ...||:|:
Yeast   182 ---------TILFLRCLFNQILNGRSQIES-------W-DMDRLESL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/147 (33%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46724
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.