DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AKR1

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_010550.1 Gene:AKR1 / 851857 SGDID:S000002672 Length:764 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:57/238 - (23%)
Similarity:88/238 - (36%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVP 100
            :.|:....:.|:.|::. |.||........||   .|.|::.....|..|.   :.::.|||.:|
Yeast   388 LSGVFFGTLLWVTIVWF-FKVMPRTFSDEQYT---NILMLVILVSVFYLFG---QLVIMDPGCLP 445

  Fly   101 RGNATKEMIEQ-------MGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCV 158
            . ....|.:.|       :|..:.:.|  |.:....||.|:....:....:.:.||:|||:.|.|
Yeast   446 E-ETDHENVRQTISNLLEIGKFDTKNF--CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDV 507

  Fly   159 GENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRT---------------CSPYSPPATI 208
            |..|.|.|:.|...:.|.....|.|.|..|.|.......|               ||.......:
Yeast   508 GLKNHKAFIFFITLMESGIFTFLALCLEYFDELEDAHEDTSQKNGKCFILGASDLCSGLIYDRFV 572

  Fly   209 FLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIE--QLKKE 249
            ||:|..   .|:..|:...::..|...|....|..|  .|.||
Yeast   573 FLILLW---ALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKE 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 35/143 (24%)
AKR1NP_010550.1 ANK repeat 75..101 CDD:293786
ANKYR 78..270 CDD:223738
ANK repeat 103..140 CDD:293786
ANK repeat 142..173 CDD:293786
ANK repeat 213..244 CDD:293786
ANK repeat 246..271 CDD:293786
COG5273 363..725 CDD:227598 57/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.