DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:209 Identity:55/209 - (26%)
Similarity:94/209 - (44%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQM----- 119
            :|||..:.:     :::...|.:||.:      |.|||.|   |...:..|::...:..|     
Human    99 LLLPLTFLL-----LVLGSLLLYLAVS------LMDPGYV---NVQPQPQEELKEEQTAMVPPAI 149

  Fly   120 -FYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL 183
             ..:|..|..::|.||.||..|:||:|:.||||||:.|||||.|...||::......:.:..|:|
Human   150 PLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYL 214

  Fly   184 VLTQFAECVKNDW---RTCSPYSPPATIFLLLFLTFEGLMFGIFTII---MLATQLTAILNDQTG 242
            .           |   |...|:........|||.||  |:..:|:::   :|.:.|..:.::.|.
Human   215 A-----------WSGLRFFQPWGQWLRSSGLLFATF--LLLSLFSLVASLLLVSHLYLVASNTTT 266

  Fly   243 IEQLKKEEARWAKK 256
            .|.:......:.::
Human   267 WEFISSHRIAYLRQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 41/132 (31%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.