DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC16

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_006718084.1 Gene:ZDHHC16 / 84287 HGNCID:20714 Length:384 Species:Homo sapiens


Alignment Length:282 Identity:75/282 - (26%)
Similarity:116/282 - (41%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WCVKDIC---GIV----CVIMTWLLILFAEFVVMRLILLPSNYTV--------FSTINMIIFQAL 80
            |.|.::.   |:|    .:::|..::..|...|:.|||  ..|:|        :|..|:|:    
Human    70 WLVDNVIRWFGVVFVVLVIVLTGSIVAIAYLCVLPLIL--RTYSVPRLCWHFFYSHWNLIL---- 128

  Fly    81 AFLAFASHIRTMLSDPGAVPRGN---ATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQR 142
              :.| .:.:.:.:.||..|:|.   ||..:              |.||...||.|.||||:|.|
Human   129 --IVF-HYYQAITTPPGYPPQGRNDIATVSI--------------CKKCIYPKPARTHHCSICNR 176

  Fly   143 CIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVH----------TLFLVLTQFAECVKNDWR 197
            |:.||||||||:|||||..|.:||..|.|::....|:          ..:..:.:..:..||..:
Human   177 CVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQ 241

  Fly   198 TCS----PYSPPAT------------IFLLL-------FLTFEGLMFGIFTIIMLATQLTAILND 239
            ..:    ..:||.|            ::|..       ||:...|..|..|:    .....|...
Human   242 AVANQTYHQTPPPTFSFRERMTHKSLVYLWFLCSLRPSFLSSVALALGALTV----WHAVLISRG 302

  Fly   240 QTGIEQ--LKKEEARWAKKSRL 259
            :|.||:  .|||..|...|.|:
Human   303 ETSIERHINKKERRRLQAKGRV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/161 (30%)
ZDHHC16XP_006718084.1 zf-DHHC 155..312 CDD:279823 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.