DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:301 Identity:81/301 - (26%)
Similarity:124/301 - (41%) Gaps:77/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSALSPGGSGGFGGVDQHNRCCGNKAWCV-----KDICG----------------IVCVIMTWLL 48
            :|:...|...|.|.:.:..|    :.|.|     :..||                ::.:..|.|.
Human    48 WSSSGSGSGSGSGSLGRRPR----RKWEVFPGRNRFYCGGRLMLAGHGGVFALTLLLILTTTGLF 108

  Fly    49 ILF-AEFVVMRLIL-LPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGN-----ATK 106
            .:| ..::..:|.| :|           ||...|.|...:..::|..:|||.:||..     |.:
Human   109 FVFDCPYLARKLTLAIP-----------IIAAILFFFVMSCLLQTSFTDPGILPRATVCEAAALE 162

  Fly   107 EMIEQMG---YR----------EGQM--FYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNN 156
            :.|:..|   ||          .|||  ...|..|...:|.|..|||||..|:.:.|||||||.|
Human   163 KQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGN 227

  Fly   157 CVGENNQKYFVLFTFYIASISVHTLFL---VLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEG 218
            |||..|.::|..|   |.|:|..|.|:   |:|......:......:....||:: |.|.:.|  
Human   228 CVGRRNYRFFYAF---ILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASV-LELVICF-- 286

  Fly   219 LMFGIFTIIMLA---TQLTAILNDQTGIEQLKKEEARWAKK 256
              |.|::|:.|:   |.|.|  ::.|..|.:|   ..|:.|
Human   287 --FSIWSILGLSGFHTYLVA--SNLTTNEDIK---GSWSSK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/132 (35%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 4/18 (22%)
zf-DHHC 191..314 CDD:279823 45/132 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.