DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT5G50020

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001190503.1 Gene:AT5G50020 / 835066 AraportID:AT5G50020 Length:444 Species:Arabidopsis thaliana


Alignment Length:329 Identity:86/329 - (26%)
Similarity:124/329 - (37%) Gaps:113/329 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLIL-----FAEFVV--MRLILLPSN-------- 65
            |||    ....|..||.:.         .|:|||:     |:.||.  :|..|||:|        
plant    47 FGG----RLIFGPDAWSIP---------FTFLLIITPVCFFSVFVATHLRRELLPNNAGHVFLVA 98

  Fly    66 ---YTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGY-----REGQ---- 118
               :|||..|       |.||       |...|||.|||.:...|  |::.|     .:|:    
plant    99 GVLFTVFVLI-------LLFL-------TSARDPGIVPRNSHPPE--EELCYDTTVSSDGRQTPT 147

  Fly   119 ---------MFY-------KCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFV 167
                     |.|       .|..|...:|.|..|||:|..|:.:.|||||||..|:|..|.:||.
plant   148 VQIPRTKEVMVYGVSVRVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGVRNYRYFF 212

  Fly   168 LFT-------FYIASISVHTLFLVLTQFAECVKNDWRTC--SPYSPPATIFLLLFLTFEGLMFGI 223
            :|.       .||.|:|...:.:::......|   ||..  ||::....|:..:.|.|.|.:.| 
plant   213 MFVSSATILCIYIFSMSALYIKVLMDNHQGTV---WRAMRESPWAVMLMIYCFISLWFVGGLTG- 273

  Fly   224 FTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNS 288
            |.:.:::|..|..            |..|:...:|:    :|:.|            .|...|..
plant   274 FHLYLISTNQTTY------------ENFRYRSDNRI----NVYNR------------GCSNNFFE 310

  Fly   289 HFYS 292
            .|.|
plant   311 TFCS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 39/135 (29%)
AT5G50020NP_001190503.1 Cation_efflux <23..114 CDD:279834 25/93 (27%)
zf-DHHC 166..291 CDD:279823 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.