DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT5G04270

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_196047.3 Gene:AT5G04270 / 830306 AraportID:AT5G04270 Length:271 Species:Arabidopsis thaliana


Alignment Length:261 Identity:83/261 - (31%)
Similarity:122/261 - (46%) Gaps:39/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIMTWLLILFAEFVVMRLIL-----LPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPR 101
            |::..|::.|..:|.:.:.:     |.|:   ...:|.::|..||.|...|....:|.|||.||.
plant    11 VLLVILVMGFVYYVTLFVFIDDWVGLQSS---AGKLNALLFSLLASLCLFSLSICVLVDPGRVPA 72

  Fly   102 GNATKEMIEQMGYREGQM--FYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQK 164
            ..|..  :|..|:....:  ..||.||.:.||.|.|||.||:||:.||||||.|:|||||..|.|
plant    73 SYAPD--VEDSGWSNSNVTETRKCDKCFAYKPLRTHHCRVCRRCVLKMDHHCLWINNCVGYANYK 135

  Fly   165 YFVLFTFYIASISVH-TLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGL-MFGIFTII 227
            .|.:..||....|:: |:.||...|    ||.    ..|:  ..:.|..|:...|: |.|:...:
plant   136 AFFILVFYATVASIYSTVLLVCCAF----KNG----DSYA--GNVPLKTFIVSCGIFMIGLSITL 190

  Fly   228 --MLATQLTAILNDQTGIEQLKKEEARW-AKKSR-----------LKSIQSVFGRFSLAWFSP-F 277
              :|...:..|.::.|.||....:.|.| |:||.           .|::.||.|...:.|..| |
plant   191 GTLLCWHIYLITHNMTTIEHYDSKRASWLARKSGQSYRHQFDVGFYKNLTSVLGPNMIKWLCPTF 255

  Fly   278 T 278
            |
plant   256 T 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 49/130 (38%)
AT5G04270NP_196047.3 DHHC 90..211 CDD:396215 49/130 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.