DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G56930

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_191252.1 Gene:AT3G56930 / 824860 AraportID:AT3G56930 Length:477 Species:Arabidopsis thaliana


Alignment Length:271 Identity:61/271 - (22%)
Similarity:98/271 - (36%) Gaps:75/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTM 92
            |...|:..:|      ::|:|.:...|                           ||     :.|.
plant    65 NPNLCIPILC------VSWILTILDIF---------------------------FL-----LMTS 91

  Fly    93 LSDPGAVPRG----------NATKEMIEQMGYREGQMFYK----------------CPKCCSIKP 131
            ..|||.|||.          ::|...:|.:..|...:...                |..|...:|
plant    92 SRDPGIVPRSFRPPETDDAPDSTTPSMEWVSGRTPNIRIPRVKDVTVNGHTVKVKFCDTCLLYRP 156

  Fly   132 ERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTL-FLVLTQFAECVKND 195
            .||.|||:|..|:::.|||||||..|:|..|.::|.:|.....::.::.. |..|..|...:...
plant   157 PRASHCSICNNCVQRFDHHCPWVGQCIGVRNYRFFFMFISTSTTLCIYVFAFSWLNIFQRHMDEK 221

  Fly   196 ---WRTCSPYSPPATIFLLLFLT--FEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAK 255
               |:..|.......:.:..|:|  |.|.: .||...::.|..|...|.:...:  |||..  ..
plant   222 ISIWKAISKDVLSDILIVYCFITVWFVGGL-TIFHSYLICTNQTTYENFRYRYD--KKENP--YN 281

  Fly   256 KSRLKSIQSVF 266
            |..|.:|..:|
plant   282 KGILGNIWEIF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 37/148 (25%)
AT3G56930NP_191252.1 DHHC 146..271 CDD:396215 36/125 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.