DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G56920

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_191251.2 Gene:AT3G56920 / 824859 AraportID:AT3G56920 Length:338 Species:Arabidopsis thaliana


Alignment Length:170 Identity:44/170 - (25%)
Similarity:70/170 - (41%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRG---------NATKEMI 109
            |.:....|:...:..|.::.:|....|.|:||.....|...|||.:||.         :.|.:..
plant    50 FSIRMAYLISHRHPFFHSLTLIGAILLTFMAFTFLFLTSSRDPGIIPRNKQVSEAEIPDVTTQST 114

  Fly   110 EQMGYREGQMFYK----------------CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCV 158
            |.:..:.|.:...                |..|...:|.||.|||:|..|:::.|||||||..|:
plant   115 EWVTSKLGSVKLPRTKDVMVNGFTVKVKFCDTCQLYRPPRAFHCSICNNCVQRFDHHCPWVGQCI 179

  Fly   159 GENNQKYFV------------LFTF-YIASISVHTLFLVL 185
            ...|..:||            :|.| :::.:.||..|.|:
plant   180 ALRNYPFFVCFLSCSTLLCIYVFVFSWVSMLKVHGEFYVV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 27/93 (29%)
AT3G56920NP_191251.2 zf-DHHC 142..263 CDD:279823 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.