DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G48760

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_190445.2 Gene:AT3G48760 / 824037 AraportID:AT3G48760 Length:476 Species:Arabidopsis thaliana


Alignment Length:298 Identity:71/298 - (23%)
Similarity:113/298 - (37%) Gaps:98/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTIN 73
            :|..|||..|.|:..|.  .|.|...::.                |:..||:..|...::..|:.
plant    13 APSSSGGVSGGDELIRT--YKGWKGNNVF----------------FLGGRLVFGPDARSILITVF 59

  Fly    74 MIIFQALAFLAFAS--------HIR---------------------TMLSDPGAVPR-------- 101
            :|....:.|..|..        |.|                     |...|||.:||        
plant    60 LITAPVIVFCIFVGRKFIDDFPHHRGVSVLAVAVGLILLDLVFLLLTSARDPGIIPRNLYPPEPE 124

  Fly   102 ---GNA--------------TKEMI-----EQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCI 144
               ||.              ||:||     .::.|        |..|...:|.||.|||:|..|:
plant   125 SNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKY--------CDTCMLYRPPRASHCSICNNCV 181

  Fly   145 RKMDHHCPWVNNCVGENNQKYFVLFTF--YIASISVHT---LFLVLTQFAECVKNDWRTCSPYSP 204
            .|.||||||:..|:|..|.:::.:|..  .:..|.||.   :::.....:|.: |.|:  |....
plant   182 EKFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYVKRIMDSENI-NIWK--SFLKT 243

  Fly   205 PATIFLLLFLTFEGLMF--GI--FTIIMLATQLTAILN 238
            ||:|.|::: ||..:.|  |:  |.:.:::|..:...|
plant   244 PASIALIIY-TFICVWFVGGLTCFHLYLMSTNQSTYEN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 39/126 (31%)
AT3G48760NP_190445.2 zf-DHHC 153..283 CDD:279823 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.