DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G26935

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_850638.1 Gene:AT3G26935 / 822311 AraportID:AT3G26935 Length:443 Species:Arabidopsis thaliana


Alignment Length:292 Identity:69/292 - (23%)
Similarity:120/292 - (41%) Gaps:61/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VKDICGIVCVIMTWLLILFAEFVVMRLI---------LLPSNYTVFSTINMIIFQALAFLAFASH 88
            |:.:...:|:|...:.| |..||..:||         .:.:...||:..::|:.           
plant    42 VRSLALTICLIAVPVTI-FCIFVARKLIDDFSDSWGVSIVAVAVVFTIYDLILL----------- 94

  Fly    89 IRTMLSDPGAVPRGNATKE---MIEQMGYREGQ----------------MFYK---CPKCCSIKP 131
            :.|...|||.:||.....|   :...|....||                :.:|   |..|...:|
plant    95 LLTSGRDPGIIPRNAHPPEPETLDGNMDAGAGQTPQLRLPRIKEVQLNGITFKVKYCDTCMLYRP 159

  Fly   132 ERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKND- 195
            .|..|||:|..|:.:.|||||||..|:|..|.::|.:|.|....:.::..........:.:::: 
plant   160 PRCSHCSICNNCVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFAFCWVYIRKIMESEH 224

  Fly   196 ---WRTCSPYSPPATIFLLLFLTFEGLMF-GIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKK 256
               |:  :....||:|.|::: ||..:.| |..|:.    .|..|..:||..|..:   .|:.::
plant   225 TTTWK--AMLKTPASIVLIIY-TFISMWFVGGLTVF----HLYLISTNQTTYENFR---YRYDRR 279

  Fly   257 SRLKSIQSVFGRFSLAWFSPFTEPSCRTRFNS 288
            |...: :.|...|...:||  |.|..:..|.:
plant   280 SNPHN-KGVVNNFKETFFS--TIPPSKNDFRA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/134 (28%)
AT3G26935NP_850638.1 DHHC 149..274 CDD:396215 37/134 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.