DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G09320

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_566348.1 Gene:AT3G09320 / 820088 AraportID:AT3G09320 Length:286 Species:Arabidopsis thaliana


Alignment Length:278 Identity:79/278 - (28%)
Similarity:126/278 - (45%) Gaps:35/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VCVIMTWLLILFAEFV-----VMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAV 99
            |.|:|  |:|.|..|.     :.|...|.|:..:   .|...|.|||.:...::...:..|||.|
plant    12 VTVVM--LVIGFIYFASVFTFIDRWFSLTSSPGI---ANAAAFTALALMCIYNYSIAVFRDPGRV 71

  Fly   100 PRG-----NATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVG 159
            |..     ...:..:.::..:.|.:.| |.||...||.|||||.||:||:.:|||||.|:|||||
plant    72 PLNYMPDVEDPESPVHEIKRKGGDLRY-CQKCSHFKPPRAHHCRVCKRCVLRMDHHCIWINNCVG 135

  Fly   160 ENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLL-LFLTFEGLMFGI 223
            ..|.|.|.:|..|..:..|::|.|::.......:::......|.  .||::: .||.   :...|
plant   136 HTNYKVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMGSYL--RTIYVISAFLL---IPLSI 195

  Fly   224 FTIIMLATQLTAILNDQTGIEQLKKEEARW-AKK-----------SRLKSIQSVFGRFSLAWFSP 276
            ...::|...:..||.::|.||..:...|.| |:|           ...:::..:.|...|:|..|
plant   196 ALGVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKGGQVYKHPYDIGAYENLTLILGPNILSWLCP 260

  Fly   277 FTEP-SCRTRFNSHFYSV 293
            .:.. ....||.:.|.|:
plant   261 TSRHIGSGVRFRTAFDSI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 45/127 (35%)
AT3G09320NP_566348.1 DHHC 94..217 CDD:396215 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2665
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.