DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT3G04970

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_187148.2 Gene:AT3G04970 / 819657 AraportID:AT3G04970 Length:397 Species:Arabidopsis thaliana


Alignment Length:258 Identity:70/258 - (27%)
Similarity:107/258 - (41%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYT----VFSTINMIIFQALAFLAF 85
            || ::...:..:..|..:..|:.|...:.|     |.:|..|.    .:::...:|...:.||. 
plant    72 CC-DRPNPILQVIYIAIMGSTYFLTAKSSF-----IYIPGYYLGDVHKYTSFLAVIVGVILFLL- 129

  Fly    86 ASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKC--CSI-KPERAHHCSVCQRCIRKM 147
                 |..||||.|...|.::.:   ..|....:.|...:|  |.| ||.|:.|||:|.||:.:.
plant   130 -----TCFSDPGTVNAENVSRYI---SAYPYDDIIYSKKECSTCKIPKPARSKHCSICNRCVARF 186

  Fly   148 DHHCPWVNNCVGENNQKYFVLFTF--------------YIASISVHTLFLV--LTQFAECVKNDW 196
            ||||.|:|||:||.|.|||:.|..              :|.:..|..|.:|  ||.:.. |...:
plant   187 DHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRVKELRVVHILTVYYG-VDKSF 250

  Fly   197 RTCSP---------YSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEE 250
            |:.:|         |:  ..|.|::||....|:...|    .|......|.:.|..|..|..|
plant   251 RSLAPRVIQWLVGTYN--TQILLMVFLAIVSLLLAGF----FAYHANLCLTNTTTNETFKWRE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/154 (31%)
AT3G04970NP_187148.2 DHHC 90..>218 CDD:388695 45/141 (32%)
DHHC 155..305 CDD:366691 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.