DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and AT2G40990

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_181632.5 Gene:AT2G40990 / 818699 AraportID:AT2G40990 Length:411 Species:Arabidopsis thaliana


Alignment Length:262 Identity:63/262 - (24%)
Similarity:97/262 - (37%) Gaps:75/262 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGNATKE-----MIEQM- 112
            |.:..:.|:...|.:|.::.::....|..|.|.....|...|||.:||.....|     ||.|. 
plant    68 FCIRMVFLIGKRYPLFHSLILLGALLLTVLDFTFLFLTSSRDPGIIPRNKEAPEAEGLDMITQSS 132

  Fly   113 ---------------------GYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNN 156
                                 ||.....|  |..|...:|.||.|||:|..|:::.|||||||..
plant   133 EWVNNKLGNTKIPRTKDILVNGYTVKVKF--CDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQ 195

  Fly   157 CVGENNQKYFV------------LFTF-YIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATI 208
            |:...|..||:            :|.| :::.:.||...|::.     :.||             
plant   196 CIALRNYPYFICFISTSTLLCLYVFVFSWVSMLEVHGKMLLMV-----ITND------------- 242

  Fly   209 FLLLFLTFEGLMFGIFTIIMLATQLTA-----ILNDQTGIEQLK----KEEARWAKKSRLKSIQS 264
                 |.|..|:...|.::.....||.     |..:||..|..:    |:|..:. |...|::..
plant   243 -----LVFVVLILYCFVVVWFVGGLTVFHLYLICTNQTTYENFRYRYDKKENPYG-KGLFKNLYE 301

  Fly   265 VF 266
            :|
plant   302 LF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/148 (26%)
AT2G40990NP_181632.5 DHHC 160..282 CDD:396215 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.