DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:290 Identity:76/290 - (26%)
Similarity:128/290 - (44%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPGGSGGFGGVDQHNRCCGNKA--WCVKDICGIVCV--IMTWL---LILFAEFVVMRLI-LLPSN 65
            |...||.|        |.|::|  |..:   |..|:  |.:||   |:....::.:::. .:|: 
Human    62 SASKSGSF--------CVGSRALPWGQR---GWSCLPTISSWLAGCLLRSCPYLAVKITPAIPA- 114

  Fly    66 YTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRG--NATKEMIEQM---------GYR---- 115
                  :..|:|    |....:.:||..||||.:||.  :...::..|:         |||    
Human   115 ------VAGILF----FFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPR 169

  Fly   116 ------EGQ---MFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTF 171
                  .||   :.| |..|...:|.||.|||:|..|:.:.|||||||.||||:.|.::|.:|..
Human   170 TKEVIINGQTVKLKY-CFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFIL 233

  Fly   172 YIASISVHTLFLVLTQ---------FAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTII 227
            .::.::|.....|:|.         |...:|:.         ||:: |...:.|    |.:::|:
Human   234 SLSFLTVFIFAFVITHVILRSQQTGFLNALKDS---------PASV-LEAVVCF----FSVWSIV 284

  Fly   228 MLATQLTAIL-NDQTGIEQLKKEEARWAKK 256
            .|:...|.:: ::||..|.:|   ..|:.|
Human   285 GLSGFHTYLISSNQTTNEDIK---GSWSNK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 41/136 (30%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.