DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:285 Identity:78/285 - (27%)
Similarity:127/285 - (44%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIMTWLL--ILFAEFVV------------MRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTM 92
            :::..||  :::||:..            :..:|||  |.:.| :|::.|..           |.
Mouse    69 IVLHLLLQGLVYAEYTCEVFGYCRELEFSLPYLLLP--YVLLS-VNLVFFTL-----------TC 119

  Fly    93 LSDPGAVPRGNATKEMIEQMGYREGQMFYK---CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWV 154
            .::||.:.:.|  :..:.|:...:..||.|   ||.|...||.|:.||.:|.||:.:.||||.||
Mouse   120 AANPGTITKAN--ESFLLQVYKFDDVMFPKNSRCPTCDLRKPARSKHCRLCDRCVHRFDHHCVWV 182

  Fly   155 NNCVGENNQKYFVLF----TFYIASISVHT------LFLVLTQFAECVKNDWRTCSPYSPPATIF 209
            |||:|..|.:||:::    |...|:|:..|      |..|...:.|...:|   ...:....|:|
Mouse   183 NNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDD---VGHFQAVDTVF 244

  Fly   210 LL--LFLTFEGLMFGIFTIIMLATQLTAIL--------NDQTGIEQLKKEEARWAKKSRLKSIQS 264
            |:  |||.|..::|.:..:|:|:..|...|        .:||..|..|.:.| |.::..|     
Mouse   245 LIQHLFLAFPRIVFLLGFVIVLSMLLAGYLCFALYLAATNQTTNEWYKGDWA-WCQRWPL----- 303

  Fly   265 VFGRFSLAWFSPFTEPSCRTRFNSH 289
                  :|| ||..||......:||
Mouse   304 ------VAW-SPSAEPRIHQNIHSH 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 49/149 (33%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 47/143 (33%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.