DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:315 Identity:81/315 - (25%)
Similarity:131/315 - (41%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTI 72
            ::|.||||.     ..||.....|        :.|:...||:.::.:.....:.:.|...:...:
Mouse     1 MAPSGSGGV-----RRRCRRVLYW--------IPVVFISLLLGWSYYAYAIQLCIVSMENIGEQV 52

  Fly    73 NMIIFQALAFLAFA-SHIRTMLSDP-----------------GAVPRGNATKEMIEQMG------ 113
            ..::...|.|..|. |:.:|:.:.|                 ...|||.|.:|::.:..      
Mouse    53 VCLMAYHLLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIY 117

  Fly   114 --YREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASI 176
              ...|.:.| |.:|..|||:|.||||||.:||.||||||||||||||.:|.|:|:||..|..  
Mouse   118 TRTMSGAIRY-CDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL-- 179

  Fly   177 SVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQT 241
             ::.||:..|.....:: .|....|.:...  |.::||.|...||.:....:.......:..:::
Mouse   180 -LYCLFIAATDLQYFIR-FWTNGLPDTQAK--FHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS 240

  Fly   242 GIEQLKKEEARWAKKSR------LKSIQSVFGRFSLAWFSP-FTE-------PSC 282
            .:|..:....|......      .|:::.|||.....|..| |:.       |:|
Mouse   241 TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFPTC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/126 (37%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 47/127 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366 81/315 (26%)
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.