DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_079704.2 Gene:Zdhhc12 / 66220 MGIID:1913470 Length:281 Species:Mus musculus


Alignment Length:291 Identity:72/291 - (24%)
Similarity:119/291 - (40%) Gaps:94/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IMTW--LLILFAE------------FVVMRL--------ILLPSNYTVFSTINMIIFQALAFLAF 85
            ::||  .|:||..            ..:.:|        :|||..:.:....:::::.|::    
Mouse    19 VLTWGITLVLFLHDTGEPDTAPPRAHPITQLRQWEEQGELLLPLTFLLLVLSSLLLYLAVS---- 79

  Fly    86 ASHIRTMLSDPGAV-----PRGNATKE---MIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQR 142
                   |.|||.|     |:|...:|   |:.|     .....:|..|..::|.||.||..|:|
Mouse    80 -------LMDPGYVTTQPQPQGEPKEEQAAMVPQ-----AVPLRRCRHCLVLQPLRARHCRDCRR 132

  Fly   143 CIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYS---- 203
            |:|:.||||||:.|||||.|...||      |.:::..:.|:           |..|..:|    
Mouse   133 CVRRYDHHCPWMENCVGERNHPLFV------AYLALQLVVLL-----------WGLCLAWSGLQF 180

  Fly   204 -PPATIFL----LLFLTFEGLMFGIFTII---MLATQLTAILNDQTGIEQLKKEEARWAKKSRLK 260
             .|..::|    |||.||  |:...|.::   :||:.|..:..:.|..|.:......:.::    
Mouse   181 FQPWGLWLRSTGLLFTTF--LLLSFFALVVALLLASHLYLVARNTTTWEFISSHRIAYLRQ---- 239

  Fly   261 SIQSVFGRFSLAWFSPFTEPSCRTRFNSHFY 291
                   |.|    :||....  ||..:||:
Mouse   240 -------RTS----NPFDRGP--TRNLAHFF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 44/138 (32%)
Zdhhc12NP_079704.2 zf-DHHC <137..231 CDD:279823 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.