DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC6

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001338011.1 Gene:ZDHHC6 / 64429 HGNCID:19160 Length:413 Species:Homo sapiens


Alignment Length:271 Identity:73/271 - (26%)
Similarity:109/271 - (40%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQAL 80
            |..:.:..|.|   .|......|::.:..|..:|   :.|:....|    :|...::|.|:....
Human    10 FENLQELKRLC---HWGPIIALGVIAICSTMAMI---DSVLWYWPL----HTTGGSVNFIMLINW 64

  Fly    81 AFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIR 145
            ..:...::...|...||.||.|  .|..|.|    :......|..|.:.|..|:|||..|.||:.
Human    65 TVMILYNYFNAMFVGPGFVPLG--WKPEISQ----DTMYLQYCKVCQAYKAPRSHHCRKCNRCVM 123

  Fly   146 KMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL-VLTQFAEC---VKNDWRTCS------ 200
            ||||||||:|||.|..|...|.||........:|..|: |:|.:.:.   :...|.|..      
Human   124 KMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYHRLSFGWNTVKIDMSAA 188

  Fly   201 -----PYSP------PATIFLLLFLTFEGLMFG--IFTIIMLATQLTAILNDQTGIEQLKKEEAR 252
                 |..|      ..|:|.|      ||..|  |...::...|:..||.::|.||...:|:| 
Human   189 RRDPLPIVPFGLAAFATTLFAL------GLALGTTIAVGMLFFIQMKIILRNKTSIESWIEEKA- 246

  Fly   253 WAKKSRLKSIQ 263
               |.|::..|
Human   247 ---KDRIQYYQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 47/149 (32%)
ZDHHC6NP_001338011.1 DHHC 95..241 CDD:396215 47/151 (31%)
SH3 317..394 CDD:418401
Di-lysine motif. /evidence=ECO:0000269|PubMed:21926431 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.