DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG18810

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster


Alignment Length:279 Identity:58/279 - (20%)
Similarity:108/279 - (38%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFL-----AFASHIRTMLSD 95
            :||:..:           :.|:..|:||.....:|.  ..:||.|..|     ..::::..:|.|
  Fly    24 LCGLPAI-----------YYVLMEIILPELSDYWSP--GYVFQLLLGLFLFSNVMSNYVMCILVD 75

  Fly    96 PGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGE 160
            |...|:  ..|..:.:..:.|.  :::|.||..:.|.|:.||..|..|:...||||.:...|:|.
  Fly    76 PSIDPK--LMKNQLVRGQHSED--WHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGH 136

  Fly   161 NNQKYFVLFTFYI----------ASISVHTL------FLVLTQFAECVKNDWRTCSPYSP--PAT 207
            .|.:||..|..|.          :||.::.|      ..:||..|           |.|.  .:.
  Fly   137 ENYRYFFYFLIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPA-----------PNSAYFNSL 190

  Fly   208 IFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKK---------EEARWAKKSRLKSIQ 263
            |..:::.....:...:||::.:...:...:......:|..:         :...:.:|.| ::.:
  Fly   191 IIRIIYFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLR-RNFK 254

  Fly   264 SVFG-RFSLAWFSPFTEPS 281
            :..| |....|.|.|. ||
  Fly   255 TFLGRRMKWTWISGFV-PS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 32/153 (21%)
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467540
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.