DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc5a

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_005160301.1 Gene:zdhhc5a / 571795 ZFINID:ZDB-GENE-090312-92 Length:760 Species:Danio rerio


Alignment Length:233 Identity:60/233 - (25%)
Similarity:89/233 - (38%) Gaps:73/233 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFL-AFASHIRTMLSDPGAVPRGNA 104
            |....||...|:       :.:|            |:..:.|: ..|:.......|||..||...
Zfish    50 CFTCPWLSEQFS-------VAVP------------IYNGVMFMFVLANFCMATFMDPGIFPRAEE 95

  Fly   105 TKE--------MIEQMGYREGQMFYK-CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGE 160
            .::        :.:.:..|..|:..| |..|...:|.|..|||||..|:...||||||||||:|.
Zfish    96 DEDKEDDFRAPLYKTVEIRGIQVRMKWCSTCRFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGR 160

  Fly   161 NNQKYFVLFTFYIASISVH--------TLFLV------------LTQFAECVKNDWRTCSPYSPP 205
            .|.:||.||   :.|::.|        .||::            :|....||..           
Zfish   161 RNYRYFFLF---LLSLTAHIMGVFGFGLLFILYHTQQLDRVHSAVTMAVMCVAG----------- 211

  Fly   206 ATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQ-TG 242
                 |.|:...||..  |.::::|...|.  |:| ||
Zfish   212 -----LFFIPVAGLTG--FHVVLVARGRTT--NEQVTG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 45/143 (31%)
zdhhc5aXP_005160301.1 zf-DHHC 116..241 CDD:279823 46/148 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.