DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc14

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:277 Identity:79/277 - (28%)
Similarity:114/277 - (41%) Gaps:60/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYT-VFSTINMIIFQALAFLAFASHI 89
            |..:....|. .|:..:.|..:|:....|.......|.||.| ....|..::|    .......:
Zfish    50 CNGRIMMAKQ-TGVFYLTMVLILVTSGLFFAFDCPFLASNLTPAIPAIGGVLF----VFVMGMLL 109

  Fly    90 RTMLSDPGAVPRGNATKEM---IEQM----------GYR----------EGQ---MFYKCPKCCS 128
            |...||||.:||  ||.|.   ||:.          |||          .||   :.| |..|..
Zfish   110 RASFSDPGVLPR--ATPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLKY-CFTCKI 171

  Fly   129 IKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVK 193
            .:|.||.|||:|..|:.:.|||||||.||||..|.::|.||   |.|:|..|:|:........:.
Zfish   172 FRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLF---ILSLSFLTIFIFAFVITHVIL 233

  Fly   194 NDWRTCSPYS-----------PPATIFLLLFLT-----FEGLM--FGIFTIIMLATQLTAIL-ND 239
            |..|.....|           |....||:|..|     .|.::  |.:::|:.|:...|.:: ::
Zfish   234 NALRKALALSTAADFEAVQKDPTGLAFLVLSKTALLDVLEVVVCFFSVWSIVGLSGFHTYLISSN 298

  Fly   240 QTGIEQLKKEEARWAKK 256
            ||..|.:|   ..|:.|
Zfish   299 QTTNEDIK---GSWSSK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 47/145 (32%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 47/146 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.