DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:303 Identity:87/303 - (28%)
Similarity:124/303 - (40%) Gaps:70/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RCCGNKAWCVKDICGIVCVIMTWLLILFAEFV--------VMRLILLPSNYTV----FSTINMII 76
            |||...              ::|:.::|...|        |:.|.:    ||:    ...|.:::
Zfish     8 RCCQRG--------------LSWIPVIFINLVVCWSYYAYVVELCI----YTIPNVNEQVIYLVV 54

  Fly    77 FQALAFLAFASHIRTMLSDPG------AVPRGNATKEMIEQMGYREGQM-----------FYK-- 122
            |.|..|:...|:.:|:.|.|.      .:|:  |.||:.|:....|.|.           .|.  
Zfish    55 FHAFFFMFMWSYWKTISSKPTNPSKEFCLPK--AEKELYEKEERPEAQQDILKRVARELPIYTFT 117

  Fly   123 -------CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHT 180
                   |.:|..|||:|.||||.|.:|:.||||||||||||||.:|.|:||||..|.....|:.
Zfish   118 GSGAIRYCDRCQLIKPDRCHHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYI 182

  Fly   181 LFLVLTQFAE----CVKNDWRTCSPYSPPAT--IFLLLFLTFEGLMFGIFTIIMLATQLTAILND 239
            ...||..|.:    |.:.....|.....|.|  .|.:|||.|...||.|..:.:.:..|..:..:
Zfish   183 AATVLQYFIKFWTLCRRRAIEHCPENQLPDTHAKFHVLFLFFVAAMFFISILSLFSYHLWLVGKN 247

  Fly   240 QTGIEQLKKEEARWAKKSR------LKSIQSVFGRFSLAWFSP 276
            :|.||..:....|......      .|:|..|||.....|..|
Zfish   248 RTTIEAFRAPVFRNGPDKNGFTLGFRKNITQVFGDQKKYWCLP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 53/141 (38%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 84/299 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.