DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc9

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001103496.1 Gene:zdhhc9 / 560095 ZFINID:ZDB-GENE-071004-8 Length:382 Species:Danio rerio


Alignment Length:279 Identity:70/279 - (25%)
Similarity:118/279 - (42%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CCGNKAWCVKD----ICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFL-A 84
            ||..:....:.    ...:..::.|..|....|...:.:.|.|:         :.:|..|.|: .
Zfish    20 CCDGRVMMARQKGVFYLTLFLIVGTCSLFFAFECPYLAVHLSPA---------IPVFAVLLFVFV 75

  Fly    85 FASHIRTMLSDPGAVPR-----GNATKEMIE-------------------QMGYREGQMFYKCPK 125
            .|..:||..||||.:||     .|..:..||                   |:..:..::.| |..
Zfish    76 MAMLLRTSFSDPGVLPRALPEEANFIEMEIEAANGNVLAGQRPPPRIKNVQINNQIVKLKY-CYT 139

  Fly   126 CCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL------- 183
            |...:|.||.|||:|..|:.:.|||||||.||||:.|.:||.|||.   |:|:.|:::       
Zfish   140 CKIFRPPRASHCSICDNCVDRFDHHCPWVGNCVGKRNYRYFYLFTL---SLSLLTIYIFAFDIVH 201

  Fly   184 -----VLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILN-DQTG 242
                 |.:.|...:|         ..|.|:..:|.     ..|.:::::.|....|.::: :||.
Zfish   202 VVLRSVDSGFVNTLK---------ETPGTVLEVLV-----CFFTLWSVVGLTGFHTYLISLNQTT 252

  Fly   243 IEQLKKEEARWAKKSRLKS 261
            .|.:|   ..|:.|:|:::
Zfish   253 NEDIK---GSWSGKNRVQN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 43/139 (31%)
zdhhc9NP_001103496.1 zf-DHHC 134..257 CDD:279823 43/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.