DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc20

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_017946765.1 Gene:zdhhc20 / 549883 XenbaseID:XB-GENE-958735 Length:375 Species:Xenopus tropicalis


Alignment Length:306 Identity:83/306 - (27%)
Similarity:124/306 - (40%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RCCGNKAWCVKDICGIVCVIMTWLLILFAEFV--------VMRLILLPSNYTVFSTINMIIFQAL 80
            |||..              ::.|:.:||...|        |:.|.:..........:.|:||..|
 Frog     8 RCCQR--------------VVGWIPVLFITAVACWSYYAFVLELCVFTIKSNAEKAVYMVIFHLL 58

  Fly    81 AFLAFASHIRTMLSDPGAVPR----GNATKEMIEQMGYREGQMFYK------------------- 122
            ..:...|:.:|:.|.|....:    ..:.||:.|:   .|.|.|.:                   
 Frog    59 FIMFIWSYWKTIFSRPANPSKEFCLSKSDKELYER---EERQEFQQEILKRAAKDLPIYTTTGTR 120

  Fly   123 ----CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL 183
                |.:|..|||:|.||||.|..|:.||||||||||||||.:|.|:|:||..|..   ::.||:
 Frog   121 AIRYCDRCQLIKPDRCHHCSTCDVCVLKMDHHCPWVNNCVGFSNYKFFLLFLMYSL---LYCLFI 182

  Fly   184 ---VLTQFAE----CVKNDWRTCSPYSPPAT--IFLLLFLTFEGLMFGIFTIIMLATQLTAILND 239
               ||..|.:    |......:|.....|.|  .|.:|||.|...||.|..:.:.:.....:..:
 Frog   183 AATVLQYFIKFWTLCRSKSEESCPQNELPDTRAKFHVLFLFFVAAMFFISILSLFSYHCWLVGKN 247

  Fly   240 QTGIEQLKKEEARWAKKSR------LKSIQSVFGRFSLAWFSP-FT 278
            ::.||..:....|...:..      .|:::.|||.....|..| ||
 Frog   248 RSTIEAFRAPLFRNGPEKDGFSLGFSKNLREVFGDEKKYWLLPMFT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 51/158 (32%)
zdhhc20XP_017946765.1 DHHC 9..310 CDD:388695 82/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.