DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc21

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001016073.1 Gene:zdhhc21 / 548827 XenbaseID:XB-GENE-855474 Length:264 Species:Xenopus tropicalis


Alignment Length:268 Identity:80/268 - (29%)
Similarity:120/268 - (44%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPS-NYTVFSTINMIIFQALAFLAFASHIRTM 92
            :.||        ||...:.:..:....:.:|||.|. :....|...:..:...:.....|.:|..
 Frog    12 QGWC--------CVGAIFFIWFYNTLFIPKLILFPRFDEGQISVAAIWAYYLTSIFCIISLLRAS 68

  Fly    93 LSDPGAV---PRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWV 154
            .:|||.:   |:...|          |.:::..|.||..::|:|:||||.|..|:|:|||||||:
 Frog    69 TADPGKLQDSPKIPLT----------EKELWELCNKCNMMRPKRSHHCSRCGHCVRRMDHHCPWI 123

  Fly   155 NNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATI----------- 208
            ||||||:|...|:...||...:|.:||.|....:.            |..|..|           
 Frog   124 NNCVGEDNHWLFLQLCFYTQLLSGYTLVLDFCHYY------------YFLPLAINWDIFIFRHEL 176

  Fly   209 FLLLFLTFEGL-MFGIFTIIMLATQLTAILNDQTGIEQLKK--EEARWAKKSRLKSIQSVFG-RF 269
            .||...||.|: |||....:.. ||:..||.|.|.||::..  :|...|:|...::...||| |:
 Frog   177 ALLRISTFMGIVMFGGMCSLFY-TQIMGILTDTTTIEKMANCCDEISRARKPWQQTFSEVFGTRW 240

  Fly   270 SLAWFSPF 277
            .:.||.||
 Frog   241 KILWFIPF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 52/140 (37%)
zdhhc21NP_001016073.1 DHHC 92..216 CDD:366691 52/136 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.