DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc2

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_021336686.1 Gene:zdhhc2 / 541365 ZFINID:ZDB-GENE-050320-58 Length:374 Species:Danio rerio


Alignment Length:332 Identity:81/332 - (24%)
Similarity:127/332 - (38%) Gaps:83/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFV--------VMRLILLPS 64
            ::|.||..|            ..|.|          :.|:.:||...:        |::|.:...
Zfish     1 MAPSGSRSF------------DCWRV----------LYWIPVLFISLIVAWSYYAYVVQLCIETI 43

  Fly    65 NYTVFSTINMIIFQALAFLAFA-SHIRTMLSDP----GAVPRGNATKEMIEQMGYREGQM----- 119
            ......|:.::|:. |.||.|. |:.:|:.|.|    ......:..||::|:...||.|.     
Zfish    44 ENMGEKTVYLLIYH-LLFLMFVWSYWQTIYSKPMNPLKEFHLSHVDKELLEREDRRESQQEILRR 107

  Fly   120 ------FYK---------CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLF 169
                  .|.         |.:|..:||:|.||||.|..||.||||||||||||||..|.|:|:||
Zfish   108 IAKDLPIYTRTMSGAIRYCDRCLLLKPDRCHHCSACDMCILKMDHHCPWVNNCVGFANYKFFMLF 172

  Fly   170 TFYIASISVHTLFLVLTQ---FAECVKNDWRT-------CSPYSPPATIFLLLFLTFEGLMFGIF 224
            ..|..   ::.||:..|.   |.:....|.:|       .:........|.::||.|....|.:.
Zfish   173 LAYSL---LYCLFVTATDMQYFIQFWTVDGKTHDRLIQYLNGLPDTQAKFHIMFLFFAASTFSVS 234

  Fly   225 TIIMLATQLTAILNDQTGIEQLKK------EEARWAKKSRLKSIQSVFGRFSLAWFSPF------ 277
            ...:.|.....:..:::.:|..:.      .:.........|:.:.|||.....|..|.      
Zfish   235 LAFLFAYHCWLVCKNRSTLEAFRAPAFQHGTDKNGFSLGAYKNFRQVFGDEKKYWLLPIFSSLGD 299

  Fly   278 --TEPSC 282
              :.|:|
Zfish   300 GCSFPTC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 45/151 (30%)
zdhhc2XP_021336686.1 zf-DHHC 11..305 CDD:327686 75/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.