DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:224 Identity:65/224 - (29%)
Similarity:100/224 - (44%) Gaps:59/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IFQALAFL-AFASHIRTMLSDPGAVPRG------------NATKEMIEQ--------MGYREGQM 119
            :|.|:.|| :.|:.:||..||||.:||.            .||...:.|        ..::....
Human    70 VFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQ 134

  Fly   120 FYK---CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTL 181
            ..|   |..|...:|.||.|||:|..|:.:.|||||||.||||:.|.:||.||   |.|:|:.|:
Human   135 IVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLF---ILSLSLLTI 196

  Fly   182 FL------------VLTQFAECVKNDWRTCSPYSPPATIF--LLLFLTFEGLMFGIFTIIMLATQ 232
            ::            :...|.|.:|         ..|.|:.  |:.|.|    ::.:..:....|.
Human   197 YVFAFNIVYVALKSLKIGFLETLK---------ETPGTVLEVLICFFT----LWSVVGLTGFHTF 248

  Fly   233 LTAILNDQTGIEQLKKEEARWAKKSRLKS 261
            |.|:  :||..|.:|   ..|..|:|:::
Human   249 LVAL--NQTTNEDIK---GSWTGKNRVQN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/143 (32%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 44/140 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.