DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:302 Identity:75/302 - (24%)
Similarity:123/302 - (40%) Gaps:72/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSALSPGGSGGFGGVDQHNRCCGNKAWCV-----KDIC----------GIVCVIMTWLLILFAEF 54
            ||.:|...|.......:..:....:.|.|     |..|          |:..:.:..:|:....|
  Rat    14 YSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQTGVFYLTLILILVTSGLF 78

  Fly    55 VVMRLILLPSNYT-VFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRG--NATKEMIEQM---- 112
            .......|....| ....:..|:|    |....:.:||..||||.:||.  :...::..|:    
  Rat    79 FAFDCRYLAEKITPAIPVVGGILF----FFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIAN 139

  Fly   113 -----GYR----------EGQ---MFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVG 159
                 |||          .||   :.| |..|...:|.||.|||:|..|:.:.|||||||.||||
  Rat   140 GTSSGGYRPPPRTKEVIINGQTVKLKY-CFTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVG 203

  Fly   160 ENNQKYFVLFTFYIASISVHTLFLVLTQ---------FAECVKNDWRTCSPYSPPATIFLLLFLT 215
            :.|.::|.:|...::.::|.....|:|.         |.:.:|:.         ||:: |...:.
  Rat   204 KRNYRFFYMFILSLSFLTVFIFAFVITHVIHRSQQKGFLDALKDS---------PASV-LEAVIC 258

  Fly   216 FEGLMFGIFTIIMLATQLTAIL-NDQTGIEQLKKEEARWAKK 256
            |    |.:::||.|:...|.:: ::||..|.:|   ..|:.|
  Rat   259 F----FSVWSIIGLSGFHTYLISSNQTTNEDIK---GSWSNK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 42/136 (31%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 42/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.