DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc13

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001008650.2 Gene:zdhhc13 / 494107 ZFINID:ZDB-GENE-041212-79 Length:645 Species:Danio rerio


Alignment Length:255 Identity:61/255 - (23%)
Similarity:106/255 - (41%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GGFGGV-DQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRL-ILLPSNYTVFSTINMII 76
            |.||.: |..     .::|.:|.|  ::..||..:.:...:...:.: .|:||...:.|...|::
Zfish   327 GAFGAILDMR-----TESWLLKGI--LLACIMAVINLASRQLATVAVRSLIPSTGLIASVFWMVV 384

  Fly    77 FQALAFL------------------AFASHIRTMLSDPGAVPRGNATKE-------MIEQMGYRE 116
            ...|.||                  ....:||:..:|||.|   .||:|       ::.:.|..:
Zfish   385 TWVLWFLPDEPSAAVQMLFTVNITAVLYYYIRSCRTDPGHV---KATEEEKKKNIVVLAEAGCLD 446

  Fly   117 GQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTL 181
            .::|  |..|...||.||:||..|..|:.|.|||..|:|.|:|..|..:||||...:..:.:...
Zfish   447 PRIF--CTSCMMRKPMRANHCFSCNACVAKQDHHSIWINGCIGARNHPFFVLFLVALNFLCIWMF 509

  Fly   182 FLVLTQFA-EC-----VKNDWRT------CSPYSPPATIFLLLFLTFEGLMFGIFTIIML 229
            :..:|.:: .|     .:..|..      |||:    .:::..|:.|......|..::.|
Zfish   510 YGSITYWSRHCPLHYSEEGIWGALTALMGCSPW----LLYVFCFVFFHTTWASILLVLQL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 33/120 (28%)
zdhhc13NP_001008650.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
ANKYR <62..204 CDD:223738
ANK repeat 76..102 CDD:293786
ANK repeat 104..135 CDD:293786
ANK 1. /evidence=ECO:0000255 104..133
PHA03095 115..>312 CDD:222980
ANK repeat 137..169 CDD:293786
ANK 2. /evidence=ECO:0000255 138..167
ANK 3. /evidence=ECO:0000255 171..200
ANK repeat 176..202 CDD:293786
ANK repeat 204..236 CDD:293786
ANK 4. /evidence=ECO:0000255 204..234
ANK repeat 239..270 CDD:293786
ANK 5. /evidence=ECO:0000255 239..268
DHHC 450..580 CDD:396215 34/122 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.